Acidiferrobacter thiooxydans: A9R16_007140 Help Entry A9R16_007140      CDS       T07877                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aty  Acidiferrobacter thiooxydans Pathway aty01100   Metabolic pathways aty01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aty00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A9R16_007140    00074 Mycolic acid biosynthesis     A9R16_007140   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A9R16_007140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PIN Motif Other DBs NCBI-ProteinID:  UEO01163 LinkDB All DBs Position 1458911..1459177 Genome browser AA seq 88 aa AA seqDB search MNSRQTDFEREIAQLLVSSLNLALDADSIDPEAPLFREGLGLDSIDMLEIALAISQHYGI QLRSDDPENAVIFASLRALAATIGARRT NT seq 267 nt NT seq  +upstreamnt  +downstreamnt gtgaatagcaggcaaaccgattttgagcgtgagattgcgcagctgctcgtgagcagcctg aacctggcgctcgatgcggactcgatcgatcccgaggccccgctgttccgcgagggtctg gggctcgattcgatcgacatgctggagattgcgttggcgatctcccagcattacggtatc caattgcgatccgatgacccggagaacgccgtcatcttcgcatccctgcgggcgctcgcc gcgaccatcggcgcgcgccggacgtaa

DBGET integrated database retrieval system