Acidiferrobacter thiooxydans: A9R16_008965 Help Entry A9R16_008965      CDS       T07877                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aty  Acidiferrobacter thiooxydans Pathway aty01100   Metabolic pathways aty01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aty00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A9R16_008965 (acpP)    00074 Mycolic acid biosynthesis     A9R16_008965 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A9R16_008965 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  UEN98569 LinkDB All DBs Position complement(1844298..1844537) Genome browser AA seq 79 aa AA seqDB search MSSIEERVKKIVVEQLGVNENEVSTDASFVDDLGADSLDTVELVMALEEEFDCEISDDEA EKITTVKQAVDYITAHAAN NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcagcatcgaagagcgggtaaaaaagattgtggtcgagcaactcggagtcaatgaa aacgaggtctcgaccgatgcatcattcgttgacgatctcggcgccgattcgcttgatacc gtggaactcgtcatggcgttggaagaggaattcgattgcgagatctcggatgacgaggcc gagaagatcacgaccgtaaagcaggcggtcgactacatcacggcgcacgccgctaattga

DBGET integrated database retrieval system