Acinetobacter tibetensis: M5E07_05590 Help Entry M5E07_05590       CDS       T08883                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism atz  Acinetobacter tibetensis Pathway atz01100   Metabolic pathways atz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:atz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M5E07_05590    00074 Mycolic acid biosynthesis     M5E07_05590   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M5E07_05590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  USE84272 UniProt:  A0AAE9LT26 LinkDB All DBs Position 1153842..1154090 Genome browser AA seq 82 aa AA seqDB search MLAQETVLEKLREWMEDLFEIAPEEVQLESNLASDLDVDSIDAIDLVVKIKELTGKQVNP EDFKNVRTVQDVVVVIQNMSAA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcttgctcaagaaaccgtgttagaaaaattacgtgaatggatggaagatttgtttgaa attgcgcctgaagaggtgcagttagaatcaaacttggcttcagaccttgatgtcgacagt attgatgccattgatttagttgtgaaaattaaagaactaacaggtaaacaagtcaatcct gaagactttaagaatgtgcgtaccgtgcaagatgtagtggtcgtgattcagaatatgtct gctgcatga

DBGET integrated database retrieval system