Aureimonas sp. AU20: M673_13060 Help Entry M673_13060        CDS       T04161                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aua  Aureimonas sp. AU20 Pathway aua01100   Metabolic pathways aua01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aua00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M673_13060    00074 Mycolic acid biosynthesis     M673_13060   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M673_13060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C DUF1493 Motif Other DBs NCBI-ProteinID:  ALN73651 LinkDB All DBs Position complement(2849246..2849482) Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVEQEKVTENASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIEKNQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgctgaacgggttaagaagatcgtcgtcgagcatctcggcgtcgagcag gagaaggtgacggaaaacgcctccttcatcgacgatctcggcgccgacagcctcgacacg gtcgagctcgtcatggccttcgaggaagagttcggcgtcgaaatcccggacgacgcggcc gagaccatcctgacggtcggcgacgcggtgaagttcatcgagaagaaccaggcctaa

DBGET integrated database retrieval system