Aureimonas sp. AU20: M673_18340 Help Entry M673_18340        CDS       T04161                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism aua  Aureimonas sp. AU20 Pathway aua01100   Metabolic pathways aua01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aua00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M673_18340    00074 Mycolic acid biosynthesis     M673_18340   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M673_18340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ALN74681 LinkDB All DBs Position pAU20a:complement(191847..192107) Genome browser AA seq 86 aa AA seqDB search MSRSEEILWEVRAVVVDTLGIDQDACPPNPSTRLFGSLPELDSFGVVELAGAIERRFGIQ LEDDDFTTETFDTLGNLADVIDAKRH NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagccgttcggaagagatcttgtgggaggtgcgcgcggtcgtcgtcgacacgctgggc atcgatcaggacgcctgcccccccaacccctccacgcgcctgttcggcagcttgccggag ctcgactccttcggcgtggtggaactggccggggccatcgagcggcgtttcggcatccag ctcgaggacgacgacttcaccaccgagaccttcgacacgctcggcaacctcgccgacgtc atcgacgccaagcggcattga

DBGET integrated database retrieval system