KEGG   Aurantimonas sp. HBX-1: LXB15_14040
Entry
LXB15_14040       CDS       T07802                                 
Symbol
phoB
Name
(GenBank) phosphate regulon transcriptional regulator PhoB
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
aub  Aurantimonas sp. HBX-1
Pathway
aub02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LXB15_14040 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:aub02022]
    LXB15_14040 (phoB)
Two-component system [BR:aub02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   LXB15_14040 (phoB)
SSDB
Motif
Pfam: Trans_reg_C Response_reg Glyco_trans_4_4
Other DBs
NCBI-ProteinID: UIJ70851
LinkDB
Position
complement(2947571..2948320)
AA seq 249 aa
MAMRIAVVEDEEALGVLLRYNLEAEGYEVDVIARGDEADIRLREEVPDLLILDWMLPGLS
GVELCRRLRQRGETERLPIIMLTARGEESERVRGLSVGADDYVVKPFSTPELIARVRAML
RRAKPEKVSSQLSAGDIDLDRETHRIRRAGREVKLGPTEFKLLEFFMQSPGRVFSREQLL
DGVWGRDIYVDERTVDVHVGRLRKAINRGRQRDPIRTVRGAGYALDEQFTAARPAAVKTR
DTAGSEPRL
NT seq 750 nt   +upstreamnt  +downstreamnt
atggccatgcggatcgccgtcgtcgaggacgaggaagcgctcggtgtgctgcttcgctac
aatctcgaggccgagggctacgaggtcgacgtgatcgcccgtggcgacgaggccgacatc
cgtctgcgcgaggaggtgcccgaccttctcatcctcgactggatgctgcccggcctgtcg
ggcgtcgagctctgccggcggctgcgccagcgcggcgagaccgagcggctgccgatcatc
atgctgacggcgcgcggcgaggagagcgagcgggtgcgcggcctgtcggtcggcgccgac
gactacgtcgtcaagccgttctcgacgccggagctgatcgcgcgggtgcgggccatgctg
cgaagagccaagccggagaaggtctccagccagctcagcgccggcgacatcgacctcgac
cgcgagacccaccggatccgccgcgccggccgcgaggtcaagctcggaccgacggagttc
aagctactggaattcttcatgcagtcgccgggccgggtgttctcccgcgagcagctgctc
gacggggtctggggccgggacatctatgtcgacgagcggacggtggacgtccatgtcggc
cggctgcgcaaggcgatcaaccggggccgccagcgcgacccgatccgcaccgtgcgcggc
gccggctacgcgctggacgagcagttcacggctgccaggcccgcggccgtgaagacccgc
gataccgcgggttcggaaccgcgcctctag

DBGET integrated database retrieval system