Aurantimicrobium photophilum: AURMO_00473 Help Entry AURMO_00473       CDS       T05480                                  Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism aum  Aurantimicrobium photophilum Pathway aum00190   Oxidative phosphorylation aum01100   Metabolic pathways Module aum_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:aum00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AURMO_00473  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:aum00194]     AURMO_00473 Photosynthesis proteins [BR:aum00194]  Photosystem and electron transport system   F-type ATPase [OT]    AURMO_00473 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AWR21089 UniProt:  A0A2Z3RWC0 LinkDB All DBs Position 449884..450120 Genome browser AA seq 78 aa AA seqDB search MDATSVLAEINGNIATVGYGLAAIGPAIGVGIVVGKTIESVARQPELAGRLQVLMYLGIA FTEALAFIGIATYFIFTN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtggacgcaacatcggttctcgccgaaatcaacggcaacattgccaccgtcggctacggt ctcgcagccattggccccgctatcggcgtaggtatcgtcgtcggcaagaccatcgagtcg gttgcacgccagcctgaacttgctggtcgtcttcaggttctgatgtacctgggtatcgct ttcaccgaggcacttgccttcatcggtatcgcgacctacttcatcttcaccaactag

DBGET integrated database retrieval system