Aurantimicrobium photophilum: AURMO_00721 Help Entry AURMO_00721       CDS       T05480                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism aum  Aurantimicrobium photophilum Pathway aum01100   Metabolic pathways aum01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aum00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AURMO_00721    00074 Mycolic acid biosynthesis     AURMO_00721   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AURMO_00721 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Ig_TRS130 Pro_sub2 DUF8402 Motif Other DBs NCBI-ProteinID:  AWR21330 UniProt:  A0A2Z3RXU1 LinkDB All DBs Position complement(697649..697894) Genome browser AA seq 81 aa AA seqDB search MALSTEEVLAGLAELVNDETGIATDTVQLDKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DEEVKNLKTVGDAVNFIVSAS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcactgtccaccgaagaagtacttgcaggtctggctgagctcgtaaacgacgaaacc ggcattgcaaccgacacggtacagctggacaagtctttcactgacgacctcgacattgac tcgatctcgatgatgaccatcgtcgtgaacgcagaagagaagttcgacgtaaagatcccc gacgaggaagtaaagaacctcaagaccgtcggcgacgcagttaacttcatcgtttctgca tcctaa

DBGET integrated database retrieval system