Actinotignum urinale: CJ184_004885
Help
Entry
CJ184_004885 CDS
T09101
Name
(GenBank) adenylate kinase
KO
K00939
adenylate kinase [EC:
2.7.4.3
]
Organism
auu
Actinotignum urinale
Pathway
auu00230
Purine metabolism
auu00730
Thiamine metabolism
auu01100
Metabolic pathways
auu01110
Biosynthesis of secondary metabolites
auu01232
Nucleotide metabolism
auu01240
Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:
auu00001
]
09100 Metabolism
09104 Nucleotide metabolism
00230 Purine metabolism
CJ184_004885
09108 Metabolism of cofactors and vitamins
00730 Thiamine metabolism
CJ184_004885
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:
auu04147
]
CJ184_004885
Enzymes [BR:
auu01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.4 Phosphotransferases with a phosphate group as acceptor
2.7.4.3 adenylate kinase
CJ184_004885
Exosome [BR:
auu04147
]
Exosomal proteins
Exosomal proteins of other body fluids (saliva and urine)
CJ184_004885
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ADK
AAA_17
AAA_33
AAA_18
Cytidylate_kin
SRP54
AAA_28
RNaseH_C
AAA
Motif
Other DBs
NCBI-ProteinID:
WIK59816
LinkDB
All DBs
Position
1165309..1165884
Genome browser
AA seq
191 aa
AA seq
DB search
MSARLIIVGPPGAGKGTQAMRIATTNGVPAISTGDLFRAHAKAQDELGKLAASYSEKGEL
VPDSVTNKMVEERLAQADAREGFLLDGYPRNLSQVDALDEILKGEKIDAVIELKVNDDVV
VQRLLGRALEQGRADDTEDVIRRRIELYHETTKPIIDAYAKRGVVLSIEGEGTIEEIGDA
IEKAVAEFLAQ
NT seq
576 nt
NT seq
+upstream
nt +downstream
nt
atgtcagcacgtctcatcatcgttggccccccaggagccggtaaaggaacccaggcaatg
cgcatcgccaccaccaacggtgttcccgcaatttccacgggagatcttttccgcgctcac
gccaaagcacaggatgaattgggtaagctcgccgcgtcttactctgaaaagggtgaactt
gttcccgattccgtgaccaacaaaatggttgaggaacgtttagcgcaagccgatgcacgc
gagggattccttctcgacggctatccgcgcaatctttcccaggtcgatgctctcgacgag
atcctcaagggtgaaaagattgacgccgttattgaactcaaggtgaacgacgacgttgtt
gtccagcgcctccttggacgcgcactcgaacagggccgtgcggacgacaccgaggacgtt
atccgtcgtcgtattgagctttaccacgaaacaacgaaacccattattgatgcctatgcc
aagcgtggcgtcgttctcagcatcgagggcgagggaaccatcgaagaaattggtgacgca
atcgaaaaagcggttgcggagtttctcgcacaataa
DBGET
integrated database retrieval system