Aurantimicrobium sp. MWH-Uga1: AURUGA1_00050 Help Entry AURUGA1_00050     CDS       T05539                                  Symbol hup Name (GenBank) DNA-binding protein HB1   KO K03530   DNA-binding protein HU-beta Organism auw  Aurantimicrobium sp. MWH-Uga1 Brite KEGG Orthology (KO) [BR:auw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:auw03032]     AURUGA1_00050 (hup)    03036 Chromosome and associated proteins [BR:auw03036]     AURUGA1_00050 (hup)    03400 DNA repair and recombination proteins [BR:auw03400]     AURUGA1_00050 (hup) DNA replication proteins [BR:auw03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AURUGA1_00050 (hup) Chromosome and associated proteins [BR:auw03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AURUGA1_00050 (hup) DNA repair and recombination proteins [BR:auw03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AURUGA1_00050 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AXE53768 UniProt:  A0A344W0N1 LinkDB All DBs Position 41394..41672 Genome browser AA seq 92 aa AA seqDB search MALNKSEVVAAVAAHTNLSQANVNGVIDALFAVVAAEVAKGGKVTIPGFISFERTNRAAR TGRNPQTGATIQIAASKSVKVSAGSKLKAAVK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggctctcaacaagtctgaggttgtcgcagcagttgccgctcacaccaacctttcacag gcaaacgtcaacggcgttatcgacgctctcttcgcagttgttgctgctgaagttgctaag ggtggaaaggtaaccatccctggcttcatctccttcgagcgcaccaaccgtgcagctcgc accggtcgtaaccctcagaccggcgcaaccatccagatcgcagcttccaagtctgtcaag gtctcggctggtagcaagctcaaggctgctgtcaagtag

DBGET integrated database retrieval system