Aurantimicrobium sp. MWH-Uga1: AURUGA1_00783
Help
Entry
AURUGA1_00783 CDS
T05539
Symbol
polC
Name
(GenBank) DNA polymerase III PolC-type
KO
K02342
DNA polymerase III subunit epsilon [EC:
2.7.7.7
]
Organism
auw
Aurantimicrobium sp. MWH-Uga1
Pathway
auw03030
DNA replication
auw03430
Mismatch repair
auw03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
auw00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
AURUGA1_00783 (polC)
03430 Mismatch repair
AURUGA1_00783 (polC)
03440 Homologous recombination
AURUGA1_00783 (polC)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
auw03032
]
AURUGA1_00783 (polC)
03400 DNA repair and recombination proteins [BR:
auw03400
]
AURUGA1_00783 (polC)
Enzymes [BR:
auw01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.7 DNA-directed DNA polymerase
AURUGA1_00783 (polC)
DNA replication proteins [BR:
auw03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
DNA polymerase III holoenzyme
AURUGA1_00783 (polC)
DNA repair and recombination proteins [BR:
auw03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
DNA polymerase III holoenzyme
AURUGA1_00783 (polC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
RNase_T
RNase_H_2
Tenui_N
Motif
Other DBs
NCBI-ProteinID:
AXE54474
LinkDB
All DBs
Position
complement(760781..761491)
Genome browser
AA seq
236 aa
AA seq
DB search
MNDVTNTGLPEWANVIAVFDTETTGIAPETTRIVSANVSVLNPYGEVEDEHNWLIDCGIE
IPEQATAVHGITTERMRSQGAPAPDSIYELLSIISSFMDQGIGVVAYNASYDFTILDREA
KRYGFDPIELPRPVIDPLIIDKQVDKYRKGKRTLEAAAAHYGVALTDAHDAAADAIAAGR
VAQAIGKKYAADLAFPAEELHDLQVTWAKEQAESYANWRRSQNLPVYPGDGIWPVR
NT seq
711 nt
NT seq
+upstream
nt +downstream
nt
gtgaatgacgtgaccaacactggattgcccgaatgggctaacgtaattgctgtttttgat
actgaaacgacgggaattgcccctgagacgacacgtatcgtctcagcgaacgtcagcgtc
ctcaatccctacggcgaggtggaagacgaacataattggctcatcgattgtggaatagaa
attccagagcaagcaacggcagtgcatggcattacgacagaacgcatgcgttcacaaggc
gcaccagctcccgacagcatctatgagctactgagtatcatttcaagctttatggatcaa
ggaattggcgtcgtcgcatacaacgcttcttatgacttcacaattcttgaccgggaagca
aaaagatacgggtttgatcccattgaactacctagaccagtaattgatccactcatcatt
gacaagcaggtcgataagtaccgcaagggcaaaagaacgttagaagctgccgctgctcat
tatggtgttgcgctcactgacgcacatgatgctgcggcagatgcaattgcagcgggacgc
gttgcccaagctattgggaaaaagtatgcagcggatctggcttttcccgctgaagagtta
catgacctccaggtgacctgggccaaggaacaagctgaaagttacgctaactggcgtcgg
agtcagaacctgccggtttaccctggagatggaatctggcctgtgagatag
DBGET
integrated database retrieval system