KEGG   Aurantimicrobium sp. MWH-Uga1: AURUGA1_01188
Entry
AURUGA1_01188     CDS       T05539                                 
Symbol
atpC
Name
(GenBank) ATP synthase epsilon chain
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
auw  Aurantimicrobium sp. MWH-Uga1
Pathway
auw00190  Oxidative phosphorylation
auw01100  Metabolic pathways
Module
auw_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:auw00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AURUGA1_01188 (atpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:auw00194]
    AURUGA1_01188 (atpC)
Photosynthesis proteins [BR:auw00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   AURUGA1_01188 (atpC)
SSDB
Motif
Pfam: ATP-synt_DE_N DUF4837 Myosin_N
Other DBs
NCBI-ProteinID: AXE54865
LinkDB
Position
complement(1184130..1184402)
AA seq 90 aa
MATSSLLQVSVVAADQEVWSGAASMVVAKTSEGEIGILPGHEPMLAILAGGEVRVTTEDG
SKITANAEGGFLSVENNNVSVVASAAELVS
NT seq 273 nt   +upstreamnt  +downstreamnt
atggctacttcttctctcctccaggtcagcgtcgtagctgccgaccaggaagtctggtct
ggcgcagccagcatggttgttgccaagaccagcgaaggcgagatcggtattctccccggt
cacgaacctatgctggcaattcttgccggcggtgaagttcgtgtcaccacggaagatggc
tcgaaaatcaccgctaacgcagagggtggtttcctttcggttgaaaataacaacgtttcc
gttgttgcctctgccgcagaattggttagctaa

DBGET integrated database retrieval system