Aurantimicrobium sp. MWH-Uga1: AURUGA1_01315 Help Entry AURUGA1_01315     CDS       T05539                                  Symbol ptsH Name (GenBank) Phosphocarrier protein HPr   KO K02784   phosphocarrier protein HPr Organism auw  Aurantimicrobium sp. MWH-Uga1 Pathway auw02060   Phosphotransferase system (PTS) Brite KEGG Orthology (KO) [BR:auw00001]  09130 Environmental Information Processing   09131 Membrane transport    02060 Phosphotransferase system (PTS)     AURUGA1_01315 (ptsH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:auw02000]     AURUGA1_01315 (ptsH) Transporters [BR:auw02000]  Phosphotransferase system (PTS)   Enzyme I and HPr    Phosphocarrier protein HPr [TC:8.A.8]     AURUGA1_01315 (ptsH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PTS-HPr Motif Other DBs NCBI-ProteinID:  AXE54991 LinkDB All DBs Position 1317616..1317891 Genome browser AA seq 91 aa AA seqDB search MPKAQRTVTVGSRVGLHARPASTFVQAVAATGHNVTITKSNGDDADGASILSVLALAVGH GEEIVLDVEGDNAEAIADELASLLTSDLDAD NT seq 276 nt NT seq  +upstreamnt  +downstreamnt ttgcctaaagctcagagaacagtcaccgttggttcgcgtgtgggactgcacgctcgcccc gccagcacttttgtgcaggcagtggcagcaaccggtcacaatgtgacgattaccaaatca aacggtgatgacgcagacggtgcaagcatcctctcggtactcgctctggcagttggacac ggtgaagaaatcgtgctcgatgtcgaaggcgacaacgctgaggccattgcagacgagctg gctagcctgctcacgtctgacctcgatgctgactaa

DBGET integrated database retrieval system