Actinomyces viscosus: NCTC10951_00938 Help Entry NCTC10951_00938   CDS       T06789                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism avc  Actinomyces viscosus Pathway avc01100   Metabolic pathways avc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:avc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC10951_00938 (acpP)    00074 Mycolic acid biosynthesis     NCTC10951_00938 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC10951_00938 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  VEI15053 UniProt:  A0A448PJJ4 LinkDB All DBs Position 1:1057114..1057365 Genome browser AA seq 83 aa AA seqDB search MAEQSNEDVLAVITQIVSEESGVDAKDITRSSTFAQDLDVDSLGLLTIATQVEERFGVAL DDSLIPTLPTVGALVDLVTTRKA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccgagcagagcaacgaggacgtcctggccgtcatcacgcagatcgtcagtgaggag tccggcgttgacgccaaggacatcacccgttccagcaccttcgcccaggacctcgacgtc gactccctggggctgctgaccatcgccacccaggtcgaggagcgcttcggcgtggctctc gatgactcccttatcccgaccctgcccaccgtcggagccctggtggatctcgtgaccacc aggaaagcctga

DBGET integrated database retrieval system