Azotobacter vinelandii CA6: AvCA6_07540 Help Entry AvCA6_07540       CDS       T02634                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism avd  Azotobacter vinelandii CA6 Pathway avd02024   Quorum sensing avd03018   RNA degradation Brite KEGG Orthology (KO) [BR:avd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AvCA6_07540 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AvCA6_07540 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:avd03019]     AvCA6_07540 (hfq)    03036 Chromosome and associated proteins [BR:avd03036]     AvCA6_07540 (hfq) Messenger RNA biogenesis [BR:avd03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AvCA6_07540 (hfq) Chromosome and associated proteins [BR:avd03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AvCA6_07540 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AGK18073 UniProt:  M9YG25 LinkDB All DBs Position 713095..713349 Genome browser AA seq 84 aa AA seqDB search MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVRLPTASEGEQPEPGNA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttaccttaataccctgcgtaaagagcgcgtt ccggtttccatctatctggtcaatggcatcaagctgcagggccagatcgagtccttcgac cagttcgtgattctgctgaagaacactgtcagccagatggtctacaagcacgcgatttcc accgtggtgccgagccgtcccgtgcgtctgcccaccgcgagcgagggcgagcagcccgaa cccggcaacgcctga

DBGET integrated database retrieval system