Azotobacter vinelandii CA6: AvCA6_13470 Help Entry AvCA6_13470       CDS       T02634                                  Symbol groES Name (GenBank) co-chaperonin GroES   KO K04078   chaperonin GroES Organism avd  Azotobacter vinelandii CA6 Brite KEGG Orthology (KO) [BR:avd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:avd03110]     AvCA6_13470 (groES)    03029 Mitochondrial biogenesis [BR:avd03029]     AvCA6_13470 (groES) Chaperones and folding catalysts [BR:avd03110]  Heat shock proteins   HSP10    AvCA6_13470 (groES) Mitochondrial biogenesis [BR:avd03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     AvCA6_13470 (groES) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 Motif Other DBs NCBI-ProteinID:  AGK18043 LinkDB All DBs Position 1312260..1312553 Genome browser AA seq 97 aa AA seqDB search MKLRPLHDRVVIRRSEEETKTAGGIVLPGSAAEKPNRGEVVAVGTGRVLDNGEVRPLAVK VGDKVVFGPYSGSNTIKVDGEDLLVMGENEIFAVVEA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaagcttcgtcctctgcatgaccgcgtcgtgattcgtcgtagcgaagaagaaaccaag accgccggcggcattgtgctgccgggctccgctgcggaaaagccgaaccgtggcgaagtc gtcgctgtgggcactggccgtgtgctggacaacggcgaagtccgtccgctggccgtgaag gtcggtgacaaggtggtgttcggcccctattccggcagcaataccatcaaggtcgatggc gaagatctgctggtgatgggcgaaaacgaaattttcgccgtcgtcgaagcctga

DBGET integrated database retrieval system