Archaeoglobus veneficus: Arcve_1244 Help Entry Arcve_1244        CDS       T01451                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism ave  Archaeoglobus veneficus Brite KEGG Orthology (KO) [BR:ave00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ave03110]     Arcve_1244 Chaperones and folding catalysts [BR:ave03110]  Protein folding catalysts   Protein disulfide isomerase    Arcve_1244 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin_3 Glutaredoxin DUF1223 DSBA Thioredoxin_4 DUF1525 Thioredoxin_2 Glrx-like Thioredoxin TraF GST_N_3 Motif Other DBs NCBI-ProteinID:  AEA47251 UniProt:  F2KMX5 LinkDB All DBs Position complement(1098977..1099222) Genome browser AA seq 81 aa AA seqDB search MAEIKLLTSPTCPYCPKAREVLKKLTEKRKDVVVLELSVTTDEGMKEALRFGIKSVPAII VNDEYVFVGVPALEELENVID NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggccgaaatcaagttgttgacatctccaacgtgcccctactgtcccaaggcgagggaa gttctgaaaaagctcaccgaaaaaaggaaggatgtagtggtcctcgaactatctgttacg acggatgaaggaatgaaagaagctcttcgcttcggaattaaaagcgttccggctataatt gtgaacgatgagtatgtatttgttggagttccggctctggaggaacttgagaatgtcatt gactga

DBGET integrated database retrieval system