Allorhizobium ampelinum: Avi_1530 Help Entry Avi_1530          CDS       T00851                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism avi  Allorhizobium ampelinum Pathway avi00998   Biosynthesis of various antibiotics avi01100   Metabolic pathways avi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:avi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Avi_1530 (acpP)    00074 Mycolic acid biosynthesis     Avi_1530 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Avi_1530 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Delta_lysin DUF7080 Motif Other DBs NCBI-ProteinID:  ACM36093 UniProt:  B9JUU8 LinkDB All DBs Position 1:1279512..1279748 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVEADKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtaaagaaaattgttattgaccatctgggcgttgaagcc gacaaggtcgttgaaggcgcaagcttcatcgacgatctcggtgcagactcgctcgacacg gtcgaactggtcatggcgttcgaagaagaattcggcgtcgagatccccgacgatgcagct gactccatcctcacggttggcgacgctgtcaagttcatcgaaaaggctcaggcttga

DBGET integrated database retrieval system