KEGG   Agrobacterium vitis: Avi_8195
Entry
Avi_8195          CDS       T00851                                 
Symbol
nos
Name
(GenBank) D-nopaline dehydrogenase
  KO
K00296  D-nopaline dehydrogenase [EC:1.5.1.19]
Organism
avi  Agrobacterium vitis
Pathway
avi00330  Arginine and proline metabolism
avi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Avi_8195 (nos)
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.19  D-nopaline dehydrogenase
     Avi_8195 (nos)
SSDB
Motif
Pfam: Octopine_DH NAD_Gly3P_dh_N F420_oxidored GIDA NAD_binding_8 Pyr_redox_2
Other DBs
NCBI-ProteinID: ACM39650
UniProt: B9K3Z5
LinkDB
Position
pTiS4:complement(138220..139356)
AA seq 378 aa
MASELSVGVIGGGHAGTALAAWFSSQKIQTAMWAPANHPGSLLSIRQHGGITASGVVEGK
HEITIHEELADLLASAKFLVLATRADVHEAFVQDLEKFVLKRPLLVICGHGFTVNYAARL
MCERILETDDSPVTAKLVGGQGNEVHIKAILPSFGVSCYPVKRDGGGNLKLPKSVSETLA
KIFGSSITVISPLHSLFFSNYIIHAVSATLNIGRLRDPEGSLTERAERWRMELESRVGAD
YRFYFYGQGTNSYVCSVIDAADKERLKVAGALGITLDTVLAECNTQSKTDYVNMREFSLA
PFPYNVNFACPDNLQHRYFSEEIRTLEMICSIAESHRVKIPVTKSIMLLIKAARGEALHA
LSLPFDPTKLSIFGARTV
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggcgtctgagctttcggttggagtcattggaggcggtcacgctggaacggctttagcg
gcctggttttcaagccagaaaattcaaacagccatgtgggctccagcaaatcatcctggt
tcattgctttcaattcgccaacatggtgggataaccgccagcggcgtggtcgaaggtaag
catgagatcactatacacgaggaattggctgatctgcttgcttcagcgaagtttctggtt
cttgcaacccgagctgacgtgcacgaagccttcgttcaagatctcgaaaagttcgtcctg
aaaaggccattgctcgtaatatgcgggcacgggttcactgtcaattacgcagctcgcttg
atgtgcgaacgaattctagaaactgacgattcccccgtaacagcaaagctggtcggcgga
caggggaacgaagttcacatcaaagcgatactgccttcgtttggtgtgtcgtgctatcca
gtgaaacgcgatggcgggggcaatttaaaactgccgaagtcagttagcgagacactggca
aagatttttggctcctcgataaccgttatctcgccactccactcgctttttttctctaac
tatataatccatgcagtttcagcgacgctcaatattggccggctgcgcgatccagaaggc
tcgcttaccgagcgcgctgagcgttggcgcatggaattggaatcccgtgtgggtgccgat
tatcgattttatttttatggccaaggcaccaatagctacgtgtgttctgtgatagatgct
gcagacaaggagcgtcttaaagttgcaggcgctttggggataacgctagatactgtcctg
gcagagtgcaatactcagtcaaagacagactatgtgaatatgagggaattcagtctggca
ccgttcccctacaacgtcaactttgcttgtcccgacaacttgcagcaccgctatttctca
gaagaaatccgtactctggaaatgatatgttcgattgccgaatcgcatcgtgtgaaaatt
ccagttacgaaaagcatcatgttgctgataaaggctgcaagaggcgaagctctacacgca
ctttcactgccgttcgatccaactaaactgtcaatctttggagcgcgcaccgtctag

DBGET integrated database retrieval system