Apaloderma vittatum (bar-tailed trogon): 104267465 Help Entry 104267465         CDS       T08559                                  Symbol CBY1 Name (RefSeq) protein chibby homolog 1   KO K23402   protein chibby 1 Organism avit  Apaloderma vittatum (bar-tailed trogon) Pathway avit04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:avit00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     104267465 (CBY1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:avit03037]     104267465 (CBY1) Cilium and associated proteins [BR:avit03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    104267465 (CBY1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Chibby Taxilin LapA_dom Motif Other DBs NCBI-GeneID:  104267465 NCBI-ProteinID:  XP_009865858 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search TFSPKKTPPRKSASLSNLHLLDRSTREIELGLEYGIPTMSLTGQSLKFENGQWVAESGSF TGDRREMQRLRKRNQQLEEENNLLRLKVDILLDMLAETTAETHLMEKELKELKNHSRQRK NT seq 363 nt NT seq  +upstreamnt  +downstreamnt accttcagcccaaagaagacccccccaaggaagagcgcctcactctccaacctgcacctg ctggatagatcaacccgtgagattgagctgggcctggaatatggcatccccaccatgagc ctcactggacagagcctcaagtttgaaaatggccagtgggtggcagaatcaggaagcttc acaggggatcgcagagaaatgcagcgcttgcgcaaacgaaaccagcagctagaggaggaa aacaacctccttcggctgaaagtggatattctgctggacatgctcgctgagaccacggct gagacccacctgatggagaaggagctgaaggagctgaagaaccacagccggcagcggaag tga

DBGET integrated database retrieval system