Apaloderma vittatum (bar-tailed trogon): 104269696 Help Entry 104269696         CDS       T08559                                  Name (RefSeq) polyubiquitin-like   KO K04551   ubiquitin B Organism avit  Apaloderma vittatum (bar-tailed trogon) Pathway avit04120   Ubiquitin mediated proteolysis avit04137   Mitophagy - animal avit04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:avit00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     104269696  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104269696    04137 Mitophagy - animal     104269696  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:avit04121]     104269696   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:avit04147]     104269696 Ubiquitin system [BR:avit04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    104269696 Exosome [BR:avit04147]  Exosomal proteins   Exosomal proteins of breast milk    104269696   Exosomal proteins of other body fluids (saliva and urine)    104269696   Exosomal proteins of colorectal cancer cells    104269696   Exosomal proteins of bladder cancer cells    104269696 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 OTU1_UBXL Dsc3_N Sde2_N_Ubi HATPase_c Motif Other DBs NCBI-GeneID:  104269696 NCBI-ProteinID:  XP_009876556 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaagaccctgactggcaagaccatcacccttgaggtggagcccagt gacaccattgagaatgtgaaggccaagatccaggacaaggaaggcattccccctgaccag cagaggctgatctttgccggcaagcagctggaagatggtcgcaccctgtctgattacaac atccagaaggaatccaccctgcacctcgtgctgcgcctgagaggtggcatgcagattttc gtcaagaccttgactggcaagaccatcacccttgaggtagagcccagtgacaccattgag aatgtgaaggccaagatccaggacaaggaggggattcctcctgaccagcagaggctgatc tttgccggcaagcagctggaagatggtcgcaccctgtccgactacaacatccagaaggaa tccaccctgcacctcgtgctgcgcctgaggggtggctgttaa

DBGET integrated database retrieval system