Apaloderma vittatum (bar-tailed trogon): 104270323 Help Entry 104270323         CDS       T08559                                  Name (RefSeq) serum amyloid A protein-like   KO K17310   serum amyloid A protein Organism avit  Apaloderma vittatum (bar-tailed trogon) Brite KEGG Orthology (KO) [BR:avit00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:avit04147]     104270323 Exosome [BR:avit04147]  Exosomal proteins   Exosomal proteins of other cancer cells    104270323 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SAA Motif Other DBs NCBI-GeneID:  104270323 NCBI-ProteinID:  XP_009862949 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MRLSVWLVLLSCVLCASADLRQGGRFVLDAAGGAWDMLRAYKDMREANYKNADKYFHARG NYDAARRGPGGAWAARVISDARENWQSGV NT seq 268 nt NT seq  +upstreamnt  +downstreamnt atgaggctctctgtctggctcgtgttgctctcctgtgtcctgtgtgcaagtgcggaccta cggcaagggggacggtttgtcttggatgcagcgggaggagcatgggatatgctcagagca tacaaggacatgcgggaggcaaattacaaaaatgccgacaaatatttccatgctcgtggg aattatgatgctgctcgaagaggacctggcggtgcttgggcagccagagtgatcagcgac gcccgggaaaactggcaaagcggggtga

DBGET integrated database retrieval system