Apaloderma vittatum (bar-tailed trogon): 104272418 Help Entry 104272418         CDS       T08559                                  Symbol RFC5 Name (RefSeq) replication factor C subunit 5   KO K10756   replication factor C subunit 3/5 Organism avit  Apaloderma vittatum (bar-tailed trogon) Pathway avit03030   DNA replication avit03410   Base excision repair avit03420   Nucleotide excision repair avit03430   Mismatch repair Brite KEGG Orthology (KO) [BR:avit00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     104272418 (RFC5)    03410 Base excision repair     104272418 (RFC5)    03420 Nucleotide excision repair     104272418 (RFC5)    03430 Mismatch repair     104272418 (RFC5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:avit03032]     104272418 (RFC5)    03036 Chromosome and associated proteins [BR:avit03036]     104272418 (RFC5)    03400 DNA repair and recombination proteins [BR:avit03400]     104272418 (RFC5) DNA replication proteins [BR:avit03032]  Eukaryotic type   DNA Replication Elongation Factors    RFC (replication factor C)     104272418 (RFC5)   DNA Replication Termination Factors    ELG1-RFC complex     104272418 (RFC5) Chromosome and associated proteins [BR:avit03036]  Eukaryotic type   Sister chromatid cohesion proteins    CTF18-RFC complex     104272418 (RFC5) DNA repair and recombination proteins [BR:avit03400]  Eukaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     RFC (replication factor C)      104272418 (RFC5)   Check point factors    HRAD17(Rad24)-RFC complex     104272418 (RFC5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Rep_fac_C RCF1-5-like_lid AAA_assoc_2 DNAX_ATPase_lid Gp44_lid Motif Other DBs NCBI-GeneID:  104272418 NCBI-ProteinID:  XP_009865707 LinkDB All DBs Position Unknown AA seq 172 aa AA seqDB search CPRFRFGPLPPELMVPRLRHVVQEEGVDVTEDGMKALVTLSSGDMRRALNILQVRVGGCG RSPQRRAAPCTGHPLKSDIANILDWMLNQDFSTAYRNITELKTLKGLALQDILTEIHLFV HRVDFPPSIRIQLLIKMADIEYRLAAGTSEKIQLSSLIAAFQVTRDLIVAEA NT seq 519 nt NT seq  +upstreamnt  +downstreamnt tgcccgcgcttccgcttcggccccctccccccggagctgatggtgccgcggctgcggcac gtcgtgcaggaggagggggtggacgtgacagaggatgggatgaaggctctggtgaccctc tcgagtggtgacatgcgcagagccctcaatatcttgcaggtacgggtcgggggttgtggt cgctctcctcagcggcgggcagccccttgcacggggcaccccctcaagtctgacattgcc aacatcctcgactggatgctgaaccaggacttttccaccgcctaccgcaacatcaccgag ctgaagacgctgaagggcttggccctgcaggacatcctcaccgagatccacctcttcgtg cacagagtcgatttcccaccctcaatccgcatccagctgctgatcaaaatggcagacatc gagtaccgactggctgctgggaccagtgaaaagatccagctgagctccctcatcgcagct ttccaagtcaccagggacctcatcgtggctgaagcctga

DBGET integrated database retrieval system