Apaloderma vittatum (bar-tailed trogon): 104277452 Help Entry 104277452         CDS       T08559                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism avit  Apaloderma vittatum (bar-tailed trogon) Pathway avit04810   Regulation of actin cytoskeleton avit05132   Salmonella infection Brite KEGG Orthology (KO) [BR:avit00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104277452 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104277452 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:avit04131]     104277452 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:avit04812]     104277452 (PFN2)    04147 Exosome [BR:avit04147]     104277452 (PFN2) Membrane trafficking [BR:avit04131]  Others   Actin-binding proteins    Others     104277452 (PFN2) Cytoskeleton proteins [BR:avit04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      104277452 (PFN2) Exosome [BR:avit04147]  Exosomal proteins   Proteins found in most exosomes    104277452 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  104277452 NCBI-ProteinID:  XP_009872391 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search PVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVG RAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 291 nt NT seq  +upstreamnt  +downstreamnt ccggtagaaatagatatgattgtaggaaaagaccgagagggtttcttcaccaacggtctg acccttggtgcgaagaagtgctctgtgatcagagatagcctgtacgtggatggcgactgc acaatggacatcaggacaaagagccaaggcggtgagcccacgtacaacgttgctgtaggc agagctggccgagtcttggtctttgtaatgggcaaagaaggggtccatggaggcggattg aataagaaggcatactcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system