Apaloderma vittatum (bar-tailed trogon): 104277479 Help Entry 104277479         CDS       T08559                                  Symbol CLDN1 Name (RefSeq) claudin-1   KO K06087   claudin Organism avit  Apaloderma vittatum (bar-tailed trogon) Pathway avit03272   Virion - Hepatitis viruses avit04382   Cornified envelope formation avit04514   Cell adhesion molecule (CAM) interaction avit04530   Tight junction Brite KEGG Orthology (KO) [BR:avit00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104277479 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     104277479 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104277479 (CLDN1)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104277479 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:avit03037]     104277479 (CLDN1)    04147 Exosome [BR:avit04147]     104277479 (CLDN1) Cilium and associated proteins [BR:avit03037]  Other cilia and associated proteins   Stereociliary proteins    104277479 (CLDN1) Exosome [BR:avit04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104277479 (CLDN1)   Exosomal proteins of colorectal cancer cells    104277479 (CLDN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF981 Cytochrom_B_C CD20 OppC_N DUF4131 DUF1218 HlyIII DUF7937 DUF4134 DUF998 Motif Other DBs NCBI-GeneID:  104277479 NCBI-ProteinID:  XP_009872420 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search HVTSKLLRIKGSLQATRALMVAAILLGLVALFVAVTGMKCMKCMEDDQVKKMRMAVFGGV IFIIAGLAALVATSWYGNRVARAFYDPFTPVNTRFEFGSALFIGWAAASLAILGGAFLCC SCPRRETSYPPTRGYPKNAPSTGKDYV NT seq 445 nt NT seq  +upstreamnt  +downstreamnt ccatgtcacatcaaaacttcttaggataaaggggagtctgcaggccactcgggctctgat ggtggctgcaatacttctgggccttgttgctctctttgttgctgtgactggcatgaaatg catgaagtgtatggaagatgaccaggtgaagaagatgcggatggctgtttttggtggggt gatcttcatcattgcaggtttggcagcgctggtggccacgtcatggtatggcaacagagt ggctcgagccttttatgaccctttcacccctgtcaacaccagatttgagtttggatcagc tcttttcataggctgggcagctgcttctctggccatcctggggggagccttcctctgctg ctcctgtccacggagagaaacttcatatccacccacccgaggctatccaaaaaatgcccc ctccacaggaaaggattatgtataa

DBGET integrated database retrieval system