Apaloderma vittatum (bar-tailed trogon): 104281270 Help Entry 104281270         CDS       T08559                                  Symbol CLDN10 Name (RefSeq) claudin-10   KO K06087   claudin Organism avit  Apaloderma vittatum (bar-tailed trogon) Pathway avit03272   Virion - Hepatitis viruses avit04382   Cornified envelope formation avit04514   Cell adhesion molecule (CAM) interaction avit04530   Tight junction Brite KEGG Orthology (KO) [BR:avit00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104281270 (CLDN10)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     104281270 (CLDN10)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104281270 (CLDN10)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104281270 (CLDN10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:avit03037]     104281270 (CLDN10)    04147 Exosome [BR:avit04147]     104281270 (CLDN10) Cilium and associated proteins [BR:avit03037]  Other cilia and associated proteins   Stereociliary proteins    104281270 (CLDN10) Exosome [BR:avit04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104281270 (CLDN10)   Exosomal proteins of colorectal cancer cells    104281270 (CLDN10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Motif Other DBs NCBI-GeneID:  104281270 NCBI-ProteinID:  XP_009877513 LinkDB All DBs Position Unknown AA seq 146 aa AA seqDB search MISAVCLGFFGAVFGLVGMKCTKVGGSDQTKAKIACLAGLIFILSGLCSMTSCSLYANRI TSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAETSNSPRRGYAYNGAASV MSARTKVHNSVPDKTPPRHFDKNAYV NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgatctccgctgtctgcctgggcttcttcggtgctgttttcggactggttgggatgaag tgtacaaaagtcggaggctccgatcagactaaagcgaaaatagcttgtttagctggactg attttcatactctctgggttgtgctctatgactagttgttccctgtatgcaaacaggatt acgtctgagttctttgatccttcttttgttgcacaaaagtatgaattaggagcagctttg ttcattggatgggctggagcttcgctctgcataattggtggcagtatattctgcttctca atagctgaaaccagtaattctccaaggagggggtatgcgtataacggagccgcatctgtg atgtctgctcgtacaaaggtccacaacagtgtcccagacaaaaccccaccaaggcacttt gacaagaacgcttacgtttaa

DBGET integrated database retrieval system