Azotobacter vinelandii CA: AvCA_17520
Help
Entry
AvCA_17520 CDS
T02633
Name
(GenBank) ABC transporter
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
avl
Azotobacter vinelandii CA
Pathway
avl02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
avl00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
AvCA_17520
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
avl02000
]
AvCA_17520
Enzymes [BR:
avl01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
AvCA_17520
Transporters [BR:
avl02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
AvCA_17520
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
AAA_29
AAA_16
SMC_N
ATP-synt_ab
AAA_23
DO-GTPase2
AAA_28
AAA_19
MukB
MMR_HSR1
Motif
Other DBs
NCBI-ProteinID:
AGK16916
LinkDB
All DBs
Position
complement(1737156..1737929)
Genome browser
AA seq
257 aa
AA seq
DB search
MLEATYKPAGDTALRVRGLSKRFEGAAAPVWSDISFDIPHGQRVAIIGGNGAGKSTLLRC
CMRLIEPDAGEVFFGDRSLSGLRGRELAKARARVGFVFQKHNLVSRLSVLTNVLHGGMAW
ARTPRMWFHGIATDEHRNYALHCLERVKLGHLCERRADELSGGQSQRVAIARALMQKPKM
IFADEPVASLDPQAGEDVMQVFSDLACDESLTLLFVTHHLEHALRYADRVLGLQDFRLGL
DASSDSLSARQLRGMYE
NT seq
774 nt
NT seq
+upstream
nt +downstream
nt
atgctggaggctacctacaaacccgccggcgatacggcgttgcgcgtccgcggcttgagc
aagcgtttcgaaggcgccgccgctcccgtgtggtccgacatttcattcgatattccgcac
gggcagcgggtggcgatcatcggcggcaatggcgccggcaaaagcaccttgctgcgatgc
tgcatgcgtctgatcgaacccgacgcgggagaagtgtttttcggcgatcggagtctcagc
ggattacgcggcagagaactggccaaggcacgcgcccgcgtcggcttcgtcttccagaag
cacaacctggtcagccgtctttccgtgctgaccaatgtgctgcacggcggcatggcctgg
gcgcgcacgccgcgcatgtggtttcacggtattgcgaccgacgagcaccggaactacgcc
ctgcattgtctggaacgggtcaaactcggccacctctgcgaacgccgggccgatgagctg
tccggcgggcaatcgcagcgtgtggccatcgcgcgcgcgctgatgcagaagccgaagatg
atattcgccgacgaacccgtcgccagtctcgacccgcaggccggggaagacgtcatgcaa
gtcttctcggacctggcgtgcgacgagtcgctcaccctgctcttcgtgacccatcatctg
gaacacgctctgcgctacgcggatcgcgttctgggactccaggatttccgcctgggcctg
gatgcgtccagcgacagtctgagcgcccggcaattgcgggggatgtatgagtga
DBGET
integrated database retrieval system