Azotobacter vinelandii CA: AvCA_19870 Help Entry AvCA_19870        CDS       T02633                                  Name (GenBank) hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism avl  Azotobacter vinelandii CA Pathway avl00190   Oxidative phosphorylation avl01100   Metabolic pathways avl02020   Two-component system Module avl_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:avl00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AvCA_19870  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AvCA_19870 Enzymes [BR:avl01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      AvCA_19870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB PIGBOS1 Motif Other DBs NCBI-ProteinID:  AGK16821 LinkDB All DBs Position complement(1974205..1974321) Genome browser AA seq 38 aa AA seqDB search MWYFSWILGILLACGFGVINALWLETTMKMDEGPAGGE NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcagttggattctcggcatcctgctggcctgtggcttcggagtcatcaac gccctttggctggaaaccaccatgaaaatggatgagggtccggcgggtggcgagtga

DBGET integrated database retrieval system