KEGG   Archangium violaceum: JQX13_07675
Entry
JQX13_07675       CDS       T07137                                 
Name
(GenBank) response regulator
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
avm  Archangium violaceum
Pathway
avm02020  Two-component system
avm02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:avm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JQX13_07675
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    JQX13_07675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:avm02022]
    JQX13_07675
   02035 Bacterial motility proteins [BR:avm02035]
    JQX13_07675
Two-component system [BR:avm02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   JQX13_07675
Bacterial motility proteins [BR:avm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    JQX13_07675
SSDB
Motif
Pfam: Response_reg TadZ_N
Other DBs
NCBI-ProteinID: QRK09971
LinkDB
Position
complement(1822191..1822559)
AA seq 122 aa
MAKRVLVVDDAIFMRNMIKDIFASGGFEVVGEAANGLEAVEKYKELKPDLTTMDIVMPFK
SGIEATREIIKYDANAVVIMCSALGQESLVMEAIEAGASDFIVKPFRAEDVLAVVKKVLG
EG
NT seq 369 nt   +upstreamnt  +downstreamnt
atggctaagcgggtgctggtcgtcgacgatgccatcttcatgcgcaacatgatcaaggac
atcttcgcgtccggcggcttcgaggtcgtcggagaggcggccaacggattggaggccgtg
gagaagtacaaggagctcaagccggatctcacgacgatggacatcgtcatgccgttcaag
agcggcatcgaggccacgcgggagatcatcaagtacgacgccaacgcggtggtcatcatg
tgctcggcgctgggacaggagagcctggtgatggaggccatcgaggcgggagcctcggac
ttcatcgtcaagccgttccgcgccgaggacgtcctggcggtcgtcaagaaggtgttgggc
gagggctga

DBGET integrated database retrieval system