Archangium violaceum: JQX13_10365 Help Entry JQX13_10365       CDS       T07137                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism avm  Archangium violaceum Pathway avm00998   Biosynthesis of various antibiotics avm01100   Metabolic pathways avm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:avm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JQX13_10365    00074 Mycolic acid biosynthesis     JQX13_10365   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JQX13_10365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 SWIB Motif Other DBs NCBI-ProteinID:  QRK10453 LinkDB All DBs Position 2413071..2413337 Genome browser AA seq 88 aa AA seqDB search MSQEEIISTLKKIMVTDLFVEIPEQNIGADDGLQSVLGLDSVGFLELRVLSEKHFQVKIP DEALSAENFQNLRTVANLVQQLRAQGRA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagccaggaagaaatcatctcaaccctcaagaagatcatggtgacggacctcttcgtc gagattcccgagcagaacatcggggccgacgatggattgcagtccgtgctggggctcgac tcggtgggcttcctcgagctgcgcgtgctcagcgagaagcacttccaggtgaagatcccc gacgaggcgctctccgcggagaacttccagaacctgcggaccgtcgcgaacctggtgcag cagctccgggcacaggggcgggcgtag

DBGET integrated database retrieval system