Agrobacterium vaccinii: HRR99_07505 Help Entry HRR99_07505       CDS       T08171                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism avq  Agrobacterium vaccinii Pathway avq02024   Quorum sensing avq03018   RNA degradation Brite KEGG Orthology (KO) [BR:avq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     HRR99_07505 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     HRR99_07505 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:avq03019]     HRR99_07505 (hfq)    03036 Chromosome and associated proteins [BR:avq03036]     HRR99_07505 (hfq) Messenger RNA biogenesis [BR:avq03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      HRR99_07505 (hfq) Chromosome and associated proteins [BR:avq03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     HRR99_07505 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  UHS61367 LinkDB All DBs Position circular:complement(1495316..1495558) Genome browser AA seq 80 aa AA seqDB search MAERSQNLQDLFLNTVRKQKISLTIFLINGVKLTGVVTSFDNFCVLLRRDGHSQLVYKHA ISTIMPGQPMQMFESEEGAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggcggaacgttctcaaaacctgcaagatctttttctcaataccgttcgcaaacaaaag atttcgttgacgatttttttgatcaacggcgtaaaactgacgggcgttgttacatccttc gacaatttctgtgttcttcttcgtcgtgacggtcattcccagcttgtttacaagcacgcg atttccacgatcatgccgggccagccgatgcagatgttcgaatcggaagagggtgcagct taa

DBGET integrated database retrieval system