KEGG   Aeromonas veronii B565: B565_0199
Entry
B565_0199         CDS       T01462                                 
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
avr  Aeromonas veronii B565
Pathway
avr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:avr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    B565_0199
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:avr03011]
    B565_0199
Ribosome [BR:avr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    B565_0199
  Bacteria
    B565_0199
  Archaea
    B565_0199
SSDB
Motif
Pfam: Ribosomal_L18p Ribosomal_L5e NmrA DUF6563 TM1506
Other DBs
NCBI-ProteinID: AEB48234
LinkDB
Position
217977..218279
AA seq 100 aa
MQELGATRLVVHRTPRHIYAQVIAANGSEVLASASTVEKAISEALKYTGNADAATAVGKA
IAERAIAKGVQNVSFDRSGFKYHGRIAALAAAARDAGLQF
NT seq 303 nt   +upstreamnt  +downstreamnt
atgcaggaactgggagctacccgtctggttgttcaccgtaccccgcgtcatatctatgcg
caggttattgcagccaacggttccgaagttctggcctctgcttccacagtagagaaagcc
atcagtgaagctctgaaatacaccggtaacgcagatgctgctaccgctgtaggtaaggct
atcgctgagcgtgctattgccaaaggcgttcagaacgtatctttcgatcgttccggtttc
aagtatcacggtcgcatcgctgccctggcagctgccgcacgtgacgctggtcttcagttc
taa

DBGET integrated database retrieval system