Agrobacterium vitis VAT03-9: RvVAT039_09910
Help
Entry
RvVAT039_09910 CDS
T08809
Name
(GenBank) ABC transporter ATP-binding protein
KO
K06147
ATP-binding cassette, subfamily B, bacterial
Organism
avv
Agrobacterium vitis VAT03-9
Brite
KEGG Orthology (KO) [BR:
avv00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
avv02000
]
RvVAT039_09910
Transporters [BR:
avv02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
RvVAT039_09910
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_membrane
ABC_tran
SMC_N
AAA_22
AAA_29
ABC_ATPase
AAA_16
Zeta_toxin
AAA_21
AAA_25
AAA_23
RsgA_GTPase
MMR_HSR1
NB-ARC
Motif
Other DBs
NCBI-ProteinID:
BCH63775
LinkDB
All DBs
Position
1:1018313..1020139
Genome browser
AA seq
608 aa
AA seq
DB search
MAGAEYGSVSENQERQAKSSRSLKPLARLNPYLMRYRGMALAALVFLALAAVTTLALPLA
VRRMIDHGMASADAGFINKYFAMLIVLALIMAASSALRYYYVITIGERIVSDIRREVFDH
VSRLSPAFFDVNQSGEIVSRLTADATQIKSAVGASASVALRNIIMCFGAMGMMIYTSPKL
SIMVLAAIPVIVFPLIAFGRSVRRRSRLAQDRLAEAAAFAGESIGAARTVQAFNGEAAAS
ARYGAAVEQAFQAARIATRSRAILTGVAITLVFGSIVGVLWYGAQSVLAGTLSAGTLGQF
LLYSVIAASSLGQLSEVWGELMQAGGAAERLTELLAEVSAVQSPDHPKPLPTPARGEVWF
ENVAFSYPSRPGRSAVKGLSFAVDAGETVAIVGPSGAGKSTIFSLILRFYDPTSGRICLD
GSDLRDVSTEALRGSIAIVPQDVTIFSGTIHDNIAFSCPDASREAVIVAARAAQATEFID
RLDHGFDTQVGERGITLSGGQRQRIAIARAILKDAPVLLLDEATSALDAESETLVQKALD
ELMKSRTTIVIAHRLATVLKADRILVIDDGKVVEQGTHQSLIQQGGIYARLARLQFQSGA
QDFLAEAK
NT seq
1827 nt
NT seq
+upstream
nt +downstream
nt
atggcaggggcggagtacggatcagtgtcggaaaaccaagaacgccaggcaaaatcgagc
cgtagtctgaagcctctcgccaggcttaacccttacctgatgcgatatcgcggcatggca
ttggccgccttggtgtttctggctctggctgccgtgaccacgctggcgctgccgctggcc
gtgcgccggatgatcgaccacggcatggcctctgccgatgccggcttcatcaacaagtat
tttgccatgctgatcgttctggcgctgatcatggccgcttccagcgcgctgcgctattat
tatgtcatcaccattggcgagcggatcgtctcggacatcaggcgcgaagtgttcgatcat
gtcagccgcctgtcgcctgcgtttttcgacgtcaaccaatccggcgaaattgtctcgcgg
ctgacagccgatgccacccagatcaaatccgccgttggcgccagcgcttctgtggcattg
cgcaacatcatcatgtgttttggcgccatgggcatgatgatctataccagcccgaaactg
tcgatcatggtgctggccgcgattccggtcatcgtctttccgctgattgcctttggccgc
tcggtgcggcgccgctcccgccttgcccaggacaggctagcggaggccgcagcctttgca
ggcgagagtattggggctgcccgtaccgtccaggcttttaatggcgaagccgccgccagc
gcccgctacggcgctgccgtcgaacaggctttccaggccgcccgtatcgccacccgctcg
cgcgccatcctgaccggtgttgccatcacgctggtattcggcagcattgtcggggtgctc
tggtatggcgcccaaagcgtgctggccggaacgctgtcagcgggaaccctgggccagttc
ctgctctattccgtcatcgccgcctcatcgcttggccaattgtccgaggtctggggtgaa
ttgatgcaggctggcggggccgccgaacggctgacggaactgctggccgaggtctctgcc
gtgcaatcgcctgatcatccaaagcccttgcccacccccgcgcgtggcgaagtgtggttt
gagaatgtcgcgttttcctatcccagccgcccgggacgctctgccgtcaaaggcctgagc
tttgccgtcgatgccggggaaaccgtggcgatcgtcggaccatcaggcgcaggtaaaagc
acgatcttctcgctgatcctgcggttctacgacccgacaagcgggcgcatctgtcttgat
ggcagtgatctgcgcgatgtgtcaacggaggcattgcgcggcagcattgccatcgtcccc
caggacgtgacgatcttttccggcacgatccacgataatattgccttcagctgccccgat
gccagccgcgaagcggtgatcgttgctgcccgcgccgcccaggccaccgagttcatcgac
cggcttgaccatggctttgacacacaggttggtgaacgcggcatcacgctttcaggcggc
cagcgtcaacgcatcgccattgcccgcgctatcctgaaggatgcgcctgtcctgctgctg
gatgaggccacctcggcgctggatgccgaaagcgaaacgctggtgcagaaagccctggat
gagctgatgaaatcacgcaccaccatcgtcatcgcccatcggctggccaccgtgctgaag
gcggaccggattcttgtcatcgacgatggcaaggtggtggaacagggcacccaccaaagc
ctgatccagcagggcggcatctatgcccggctggcccggctgcaattccagagcggcgcg
caggatttcctggcagaagcgaagtaa
DBGET
integrated database retrieval system