Agrobacterium vitis VAT03-9: RvVAT039_pl09180 Help Entry RvVAT039_pl09180  CDS       T08809                                  Symbol hupT_1 Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism avv  Agrobacterium vitis VAT03-9 Brite KEGG Orthology (KO) [BR:avv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:avv03032]     RvVAT039_pl09180 (hupT_1)    03036 Chromosome and associated proteins [BR:avv03036]     RvVAT039_pl09180 (hupT_1)    03400 DNA repair and recombination proteins [BR:avv03400]     RvVAT039_pl09180 (hupT_1) DNA replication proteins [BR:avv03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RvVAT039_pl09180 (hupT_1) Chromosome and associated proteins [BR:avv03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RvVAT039_pl09180 (hupT_1) DNA repair and recombination proteins [BR:avv03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RvVAT039_pl09180 (hupT_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Glycos_trans_3N Integrase_Zn Motif Other DBs NCBI-ProteinID:  BCH68085 LinkDB All DBs Position pTiRvVAT039:4958..5236 Genome browser AA seq 92 aa AA seqDB search MTTTNEIADKIASEQSLTRAQAKTIVESVFKHITDAALACAETSIPSFGKFKIKDTPERQ GRNPATGATIKIAASKKLTFTPGKAVKDALNA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaccaccacaaacgaaattgctgacaagatcgcatccgagcagagcctaacaagggcg caggccaagaccattgtcgaaagcgtctttaaacatatcactgatgctgctcttgcctgc gcggaaacgtcgattccgtcgttcggcaaattcaaaatcaaggacactccggaacgccaa ggccgcaatccggccacgggcgcaacgatcaagatcgccgcatcgaagaagctgaccttt acacccggcaaggccgtcaaggatgcgctgaacgcatga

DBGET integrated database retrieval system