Anabaena sp. WA102: AA650_16170 Help Entry AA650_16170       CDS       T04059                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism awa  Anabaena sp. WA102 Pathway awa00998   Biosynthesis of various antibiotics awa01100   Metabolic pathways awa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:awa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AA650_16170    00074 Mycolic acid biosynthesis     AA650_16170   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AA650_16170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ALB41789 LinkDB All DBs Position 3685363..3685623 Genome browser AA seq 86 aa AA seqDB search MVTREEVKTILAQTLSMSSAELADETPLEGGEIESLSYVEMLLAIESQYGITASDDELES VKDIGNLSQLIVDKIYASHQQDTFIS NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggttactagagaagaagtaaagacaatcctggcgcaaactttaagtatgtcatcggct gaattagcagatgaaactcctttagaaggtggtgaaatagaatctctttcttatgttgag atgctattagcgatagaatctcaatatggaattaccgcttcagatgatgaactagaaagt gtgaaagatattggtaatttgagtcagttaattgtggacaaaatatatgcgagtcatcaa caagatacctttatttcctaa

DBGET integrated database retrieval system