Acetobacterium woodii: Awo_c19200 Help Entry Awo_c19200        CDS       T01732                                  Symbol acpP1 Name (GenBank) acyl carrier protein AcpP1   KO K02078   acyl carrier protein Organism awo  Acetobacterium woodii Pathway awo01100   Metabolic pathways awo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:awo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Awo_c19200 (acpP1)    00074 Mycolic acid biosynthesis     Awo_c19200 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Awo_c19200 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  AFA48699 UniProt:  H6LJD6 LinkDB All DBs Position complement(2281591..2281812) Genome browser AA seq 73 aa AA seqDB search MVLEKVVEILRNYKDEQDLEVTIDSTFEELELDSLDTVELVMEIEESFDTSIEMDGEIQT IGDVVNLIEKAIA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggtattagaaaaagtagtggaaattttacggaattataaagacgaacaagatttagaa gttacaattgactcaacatttgaagaactagagttggattctctcgatacggtggaattg gtgatggaaatcgaagagtcgtttgataccagtattgaaatggatggcgaaattcagacc atcggggacgtagtcaacctcattgaaaaagcaatcgcttag

DBGET integrated database retrieval system