Alloalcanivorax xenomutans: P40_03440 Help Entry P40_03440         CDS       T04770                                  Name (GenBank) toxin of toxin-antitoxin system   KO K19158   toxin YoeB [EC:3.1.-.-] Organism axe  Alloalcanivorax xenomutans Brite KEGG Orthology (KO) [BR:axe00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02048 Prokaryotic defense system [BR:axe02048]     P40_03440 Prokaryotic defense system [BR:axe02048]  Toxin-antitoxin system (TA system)   Type II TA system    YoeB-YefM     P40_03440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YoeB_toxin ParE_toxin ParE-like_toxin HigB-like_toxin Motif Other DBs NCBI-ProteinID:  ARB44593 UniProt:  A0A9Q3W5R7 LinkDB All DBs Position 736001..736264 Genome browser AA seq 87 aa AA seqDB search MTWKLVYTRHAQKDARKLVSNGLKPKAQELLALLAEDPYRKPPPFEKLVGDLAGAYSRRI NIQHRLVYQVLESERVVKVLRLWSHYE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtgacatggaagttggtttatacccggcacgcgcagaaagacgcaaggaagctggtctca aacggtctgaaaccgaaagctcaggagttgctggcgctgctcgcggaagatccgtatcgg aagccgcccccgttcgagaagctggttggtgatctggcgggggcttattcccgccgtatc aacatccagcaccggttggtgtatcaggtacttgagagcgaacgggtggtgaaggtgctt cggctttggagtcactacgaatag

DBGET integrated database retrieval system