Alloalcanivorax xenomutans: P40_03635 Help Entry P40_03635         CDS       T04770                                  Name (GenBank) protein hfq   KO K03666   host factor-I protein Organism axe  Alloalcanivorax xenomutans Pathway axe02024   Quorum sensing axe03018   RNA degradation Brite KEGG Orthology (KO) [BR:axe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     P40_03635  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     P40_03635  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:axe03019]     P40_03635    03036 Chromosome and associated proteins [BR:axe03036]     P40_03635 Messenger RNA biogenesis [BR:axe03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      P40_03635 Chromosome and associated proteins [BR:axe03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     P40_03635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ARB44627 UniProt:  A0A9Q3W2E8 LinkDB All DBs Position 780306..780605 Genome browser AA seq 99 aa AA seqDB search MSKGHSLQDPFLNALRKERIPVSIFLVNGIKLQGQIESFDQYVVLLKNAVSQMVYKHAIS TVVPARNPRASGGGNPAMHGTTGAAGGGQAGAGDEYGNQ NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcattcgctacaagacccttttctcaatgcgctgagaaaggaacgtatt ccggtttctatctttctggttaacggaatcaaactgcaggggcaaatcgagtctttcgac cagtacgtggtactgctgaaaaacgcggtaagccaaatggtgtataagcatgccatttcc accgtggtgcccgcccgcaacccgcgtgcgtccggcggtggcaatccggccatgcatggc accaccggtgccgccggcggcggccaggctggggcgggtgacgaatacggtaatcaatag

DBGET integrated database retrieval system