Alloalcanivorax xenomutans: P40_11430 Help Entry P40_11430         CDS       T04770                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism axe  Alloalcanivorax xenomutans Brite KEGG Orthology (KO) [BR:axe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:axe03032]     P40_11430    03036 Chromosome and associated proteins [BR:axe03036]     P40_11430    03400 DNA repair and recombination proteins [BR:axe03400]     P40_11430 DNA replication proteins [BR:axe03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     P40_11430 Chromosome and associated proteins [BR:axe03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     P40_11430 DNA repair and recombination proteins [BR:axe03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       P40_11430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 FIMAH HU-DNA_bdg VWA_3 Motif Other DBs NCBI-ProteinID:  ARB45946 UniProt:  A0A9Q3W4R3 LinkDB All DBs Position complement(2481221..2481493) Genome browser AA seq 90 aa AA seqDB search MNKSELIDAIAAAADISKADAGRALDATLEAITGALKKGDSVSLVGFGTFSVKQRAAREG RNPQTGETIKIAAATVPGFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataaatcagaactgattgatgcgatcgcagcggctgctgacatttccaaagccgac gcgggtcgtgctctggatgcgacgctggaagcgatcaccggtgcactgaagaaaggcgat agcgtttctctggttggcttcggtactttctccgtgaagcagcgtgccgctcgtgaaggc cgcaatccgcagaccggtgagaccatcaagatcgccgcagccaccgtgccgggcttcaaa gccggcaaggcactgaaagacgcggtgaactaa

DBGET integrated database retrieval system