Achromobacter xylosoxidans NH44784-1996: NH44784_039701 Help Entry NH44784_039701    CDS       T02785                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism axo  Achromobacter xylosoxidans NH44784-1996 Pathway axo00998   Biosynthesis of various antibiotics axo01100   Metabolic pathways axo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:axo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NH44784_039701    00074 Mycolic acid biosynthesis     NH44784_039701   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NH44784_039701 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF5856 NBD94 DUF1493 Motif Other DBs NCBI-ProteinID:  CCH07914 LinkDB All DBs Position complement(4237107..4237367) Genome browser AA seq 86 aa AA seqDB search MQTREEIYNTLRDTLNELFEVELERITPQANLYTDLQIDSIDAIDLIDQVRRKTGRKLDA NDFRSVRTVDDVVQAMYQKQQQDADA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcagacccgcgaggaaatctacaacacgctgcgcgatacgctcaacgagttgttcgag gtcgagctcgaacgcatcacgccgcaggccaacctgtacaccgacctccagatcgacagc atcgacgctatcgacctgatcgaccaggtgcgccgcaagaccggccgcaagctcgacgcc aacgattttcgcagcgtccgtaccgttgacgacgtggtgcaggccatgtaccagaagcag caacaggacgccgacgcatga

DBGET integrated database retrieval system