KEGG   Achromobacter xylosoxidans NCTC10807: ERS451415_04680
Entry
ERS451415_04680   CDS       T04522                                 
Symbol
proV
Name
(GenBank) Glycine betaine/L-proline transport ATP-binding protein ProV
  KO
K02000  glycine betaine/proline transport system ATP-binding protein [EC:7.6.2.9]
Organism
axx  Achromobacter xylosoxidans NCTC10807
Pathway
axx02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:axx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ERS451415_04680 (proV)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:axx02000]
    ERS451415_04680 (proV)
Enzymes [BR:axx01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.9  ABC-type quaternary amine transporter
     ERS451415_04680 (proV)
Transporters [BR:axx02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter
    ERS451415_04680 (proV)
SSDB
Motif
Pfam: ABC_tran CBS AAA_21 ABC_ATPase AAA_22 AAA_16 ATPase_2 AAA_29 RsgA_GTPase Viral_helicase1 TniB AAA_15 AAA_14 AAA_33 SbcC_Walker_B AAA_18
Other DBs
NCBI-ProteinID: CKH99636
LinkDB
Position
1:complement(5136221..5137519)
AA seq 432 aa
MSKIEVKNIYKIFGPHPKKWLEAAQGGMSKEALLAESGHTLGLRDISLSIEEGSIYVIMG
LSGSGKSTLIRHFNRLIEPSAGHILVDGVDVVSLNKRDLETFRQKKMSMVFQRFGLFPHR
TVLDNAAYGLAVQGVGRAEREQRAREWLEQVGLSGFEQQYPHQLSGGMQQRVGLARALAT
DAEILLMDEAFSALDPLIRREMQDQLLQLQSKLNKTIVFITHDLDEALRLGNRIAILKDG
ELVQEGTPEDILLNPANDYVQSFLQDVNRTKVLNATHAVNPARLTLTMRSRPAHSVDRMR
ALNYEYAPVLDGKRLAGVLTLEAAEQAVREGGRDVSRFVEDLASVPATAGLGEVLAQLVH
SDQPVAVTGENDEFIGMLSRKKVVELVTPVLAESAPAAESSESAEPPPATGGDPAQAELQ
GQPQPTQRGEAA
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgagcaagatcgaagtcaagaacatctacaagattttcgggccgcatccgaagaaatgg
ctggaagccgcgcagggcggcatgagcaaggaagcgctgctggccgaaagcgggcacacg
ctgggcctgcgcgacatcagcctgtcgatcgaagagggcagcatctacgtcatcatgggc
ctgtcggggtccggcaagtcgacgctgatccgccacttcaaccgcctgatcgagcccagc
gccggccacatcctggtcgacggcgtcgacgtcgtcagcctgaacaagcgcgacctggag
accttccgccagaagaagatgagcatggtgttccagcgcttcggcctgttcccgcaccgc
accgtgctggacaacgccgcctacggcctggccgtgcagggcgtgggccgcgccgagcgc
gagcagcgcgcccgcgaatggctggagcaggtcggcctgtcgggcttcgagcagcagtat
ccgcaccagctgtcgggcggcatgcagcagcgcgtgggcctggcgcgcgcgctggccacc
gacgccgagatcctgctgatggacgaggccttctcggcgctcgacccgctgatccgccgc
gagatgcaggaccagctgctgcaactgcaatccaagctcaacaagactatcgtcttcatc
acccatgacctggacgaagcgctgcgcctgggcaaccgcatcgccatcctgaaggacggc
gagctggtgcaggaaggcacgcccgaagacatcctgctgaatccggccaacgattacgtg
cagtcgttcctgcaggacgtgaaccgcaccaaggtgttgaacgcgacccacgcggtgaac
ccggcgcgcctgacgctgaccatgcgatcgcgcccggcccattcggtcgatcggatgcgc
gcgctgaactacgagtacgcgccggtgctggacggcaagcggctggccggcgtgctgacg
ctggaagcggccgaacaggccgtgcgcgagggcggacgcgacgtgtcgcgcttcgtcgag
gacctggcttcggtgccggccacggccggcctgggcgaagtgctggcgcagctggtgcac
agcgaccagccggtagccgtgacgggcgagaacgacgagttcatcggcatgctgtcgcgc
aagaaggtggtcgagctggtgacgccggtgttggccgagagcgcgcccgcggccgaatcc
agcgaatccgccgaaccgccgcccgccaccggcggcgacccggcccaggccgagctgcaa
ggccagccccagccgacgcaacggggcgaggccgcctga

DBGET integrated database retrieval system