Achromobacter xylosoxidans A8: AXYL_00783 Help Entry AXYL_00783        CDS       T01341                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism axy  Achromobacter xylosoxidans A8 Brite KEGG Orthology (KO) [BR:axy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:axy03036]     AXYL_00783 (ftsL) Chromosome and associated proteins [BR:axy03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AXYL_00783 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC NrS1-1_pol-like_head Motif Other DBs NCBI-ProteinID:  ADP14133 UniProt:  E3HGD3 LinkDB All DBs Position 831672..831962 Genome browser AA seq 96 aa AA seqDB search MGRVNLIVAALLMLSAISLVTSRYQSRQLFIELGRDQAHARDLETSWRRLQLDRAELARN ARVDAIAREGLKMISIVPDRTLYMNQAPVSASGGAQ NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgggtcgcgtcaacctgatcgttgcggctttactgatgctgtcggccatttccctggtc accagccggtatcagtcgcgccagctctttatcgagctgggccgcgatcaggcgcacgca cgcgaccttgaaaccagttggcggcgtctgcagctggaccgcgccgaactcgcccgcaac gcgcgggtggacgctattgcgcgtgagggcctgaagatgatttccatcgttccggaccgc acgctgtacatgaatcaggcgcctgtctccgccagcggaggcgcgcaatga

DBGET integrated database retrieval system