Achromobacter xylosoxidans A8: AXYL_02359 Help Entry AXYL_02359        CDS       T01341                                  Name (GenBank) acyl carrier domain protein   KO K02078   acyl carrier protein Organism axy  Achromobacter xylosoxidans A8 Pathway axy00998   Biosynthesis of various antibiotics axy01100   Metabolic pathways axy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:axy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AXYL_02359    00074 Mycolic acid biosynthesis     AXYL_02359   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AXYL_02359 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADP15680 UniProt:  E3HL07 LinkDB All DBs Position complement(2500259..2500519) Genome browser AA seq 86 aa AA seqDB search MNQLEFELKTLVIESLGLEDIAPDDIDSDAHLFGDGLGLDSVDALELGLALQKRYGITID PETRNMREHFASIAKLAEFVSAQRRA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaaccaactggaatttgaactgaagaccctcgtcatcgaatcgctgggcctggaagac atcgcgcccgacgatatcgacagcgacgcccacctgttcggcgacgggctcgggctggat tcggtggacgccctggagctgggccttgcgctgcagaagcgctacggcatcaccatcgat cccgaaacgcgcaacatgcgcgagcatttcgccagcatcgccaagctggccgagtttgtc agcgcgcaacgccgcgcctaa

DBGET integrated database retrieval system