Achromobacter xylosoxidans A8: AXYL_06132 Help Entry AXYL_06132        CDS       T01341                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism axy  Achromobacter xylosoxidans A8 Pathway axy00190   Oxidative phosphorylation axy01100   Metabolic pathways axy02020   Two-component system Module axy_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:axy00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AXYL_06132  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AXYL_06132 Enzymes [BR:axy01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      AXYL_06132 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ADP19425 UniProt:  E3HMR8 LinkDB All DBs Position complement(6603554..6603679) Genome browser AA seq 41 aa AA seqDB search MWYFSWILGLGLACAFAILNAMWFELREGHTHDPRASRNDA NT seq 126 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttctcgtggatactcggtctgggcctggcgtgtgccttcgccattctcaat gcaatgtggttcgagctgcgcgaggggcatacgcatgacccgcgcgccagccgcaatgac gcgtga

DBGET integrated database retrieval system