KEGG   Achromobacter xylosoxidans A8: AXYL_06561
Entry
AXYL_06561        CDS       T01341                                 
Symbol
cbnA
Name
(GenBank) chlorocatechol 1,2-dioxygenase
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00361  Chlorocyclohexane and chlorobenzene degradation
axy01100  Metabolic pathways
axy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:axy00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    AXYL_06561 (cbnA)
Enzymes [BR:axy01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     AXYL_06561 (cbnA)
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg
Other DBs
NCBI-ProteinID: ADP19850
UniProt: Q8GFI0
LinkDB
Position
pA81:complement(24017..24772)
AA seq 251 aa
MNERVKQVASALVDAIQKTLTEQRVTEEEWRAGVGYMMKLAEAKEMALLLDVFFNHTIVD
LKAQATRGSTPAIQGPYFLEGAPVVAGALKTYEDDSHHPLVIRGAVRTDDGAPAAGAVID
VWHSTPDGKYSGFHDQIPTDLYRGKVVADAQGKYAVRTTMPAPYQIPNKGPTGVLLEMMG
SHTWRPAHVHFKVRKDGFVPLTTQYYFEGGDWVDSDCCKGVAPDLVMPAKTEGGAQVMAI
DFVIERPREHA
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaacgaacgagtgaagcaggttgcgtccgcattggtggatgcgatccagaagaccctc
acggagcaacgcgtgacggaagaagagtggcgcgcgggcgtcggctacatgatgaaactg
gccgaggccaaggaaatggctctcctgctggacgtgttcttcaaccacacgatcgtcgac
ctcaaagcccaggccacgcgcggatccacgcccgcgatccagggcccgtatttcctggaa
ggcgccccggtggtcgccggcgccctgaagacctacgaggatgactcgcatcacccgctc
gtgatccgcggcgccgtgcgcacggacgatggcgcgccagccgcgggagccgtgatcgac
gtgtggcactccacgcccgacggcaagtacagcggctttcatgaccagatcccgaccgac
ttgtaccgcggcaaggtcgtggccgatgcgcagggcaagtacgccgtgcgcaccaccatg
cccgccccgtaccagatcccgaacaagggaccgaccggcgtgctgcttgaaatgatggga
agccatacgtggcgtcccgcgcacgtgcacttcaaggtgcgcaaggacgggttcgtgccg
ctgaccacgcagtactacttcgaaggcggcgactgggtcgacagcgactgctgcaagggt
gtcgcaccggacctggtcatgccggcaaagaccgagggcggcgcgcaggtgatggccatc
gacttcgtcatcgaacgaccccgggagcacgcatga

DBGET integrated database retrieval system