Ilumatobacter coccineus: YM304_18660 Help Entry YM304_18660       CDS       T02501                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aym  Ilumatobacter coccineus Pathway aym00998   Biosynthesis of various antibiotics aym01100   Metabolic pathways aym01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aym00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     YM304_18660 (acpP)    00074 Mycolic acid biosynthesis     YM304_18660 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     YM304_18660 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BAN02180 UniProt:  A0A6C7E6U9 LinkDB All DBs Position 2072425..2072721 Genome browser AA seq 98 aa AA seqDB search MPAETHVEQGPLGRDEILQIVRDRLADILEIEPASVNEGDSFVDDLDADSLALIELVEGL EEEIGERTVGFRIEDEDLEDLKTVRDAVDYVHERVGKS NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgccagccgaaacacatgtcgaacagggcccgctcggccgagacgagatcctccagatc gtgcgcgatcggttggccgacatcctcgagatcgagccagccagcgtcaacgaaggtgac tcgttcgtcgacgacctcgacgccgactccctcgcactgatcgaactggtcgaaggcctc gaagaagagatcggcgaacgcaccgtcggtttccgcatcgaagacgaagacctcgaagac ctcaagaccgttcgcgacgccgtcgactacgtccacgaacgcgtcggcaagagctga

DBGET integrated database retrieval system