Azoarcus sp. DN11: CDA09_10270 Help Entry CDA09_10270       CDS       T05691                                  Name (GenBank) phenol hydroxylase   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism azd  Azoarcus sp. DN11 Pathway azd00361   Chlorocyclohexane and chlorobenzene degradation azd00362   Benzoate degradation azd00623   Toluene degradation azd01100   Metabolic pathways azd01120   Microbial metabolism in diverse environments azd01220   Degradation of aromatic compounds Module azd_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:azd00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CDA09_10270    00361 Chlorocyclohexane and chlorobenzene degradation     CDA09_10270    00623 Toluene degradation     CDA09_10270 Enzymes [BR:azd01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      CDA09_10270     1.14.13.244  phenol 2-monooxygenase (NADH)      CDA09_10270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  AYH43767 LinkDB All DBs Position 2256833..2257192 Genome browser AA seq 119 aa AA seqDB search MAVAALRKYEFEPADAPAKFHGAQLLYVGWEDHLMFCAPFAFPLPPTMPFGTVVEQVLPG AFGYHPDFARIDWAKAEWFKSGRRWMPDFGKSLADNGLGHKDVIRFRTPGLTGIAGSCS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggccgttgctgccctgcgcaaatacgagttcgagcccgccgacgcgccggcgaaattc cacggcgcccaactgctgtacgtgggctgggaagaccacctgatgttctgcgcgcccttc gcctttccgctgccgccgacgatgcctttcggcaccgtcgtcgagcaggtgttgccgggc gcgttcggttaccacccggacttcgcccgcatcgactgggcgaaggccgagtggttcaag tcgggccggcgctggatgccggatttcggcaagtcgctcgccgacaacgggctgggtcac aaggacgtgatccgcttccgcaccccggggctgacgggaatcgccggctcctgcagctag

DBGET integrated database retrieval system