Azoarcus sp. DN11: CDA09_10345 Help Entry CDA09_10345       CDS       T05691                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism azd  Azoarcus sp. DN11 Pathway azd00362   Benzoate degradation azd00621   Dioxin degradation azd00622   Xylene degradation azd01100   Metabolic pathways azd01120   Microbial metabolism in diverse environments azd01220   Degradation of aromatic compounds Module azd_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:azd00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CDA09_10345    00622 Xylene degradation     CDA09_10345    00621 Dioxin degradation     CDA09_10345 Enzymes [BR:azd01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      CDA09_10345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 Motif Other DBs NCBI-ProteinID:  AYH43782 LinkDB All DBs Position 2272784..2272975 Genome browser AA seq 63 aa AA seqDB search MPFAQIYLVEGRSEEQKRAVIEKVTQALVEAVGAPKENVRVWIQDVPKTNWGIAGQTAKD LGR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgccattcgcccaaatctacctcgtggaaggacgcagcgaggagcagaagcgcgcggtg atcgagaaggtcacccaggccctcgtcgaggccgtcggcgcgccgaaggagaacgtccgc gtgtggatccaggacgtgcccaagaccaactggggcattgccggacagaccgcgaaagac ctcgggcgctga

DBGET integrated database retrieval system