Azoarcus sp. DN11: CDA09_10425 Help Entry CDA09_10425       CDS       T05691                                  Name (GenBank) phenol hydroxylase   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism azd  Azoarcus sp. DN11 Pathway azd00361   Chlorocyclohexane and chlorobenzene degradation azd00362   Benzoate degradation azd00623   Toluene degradation azd01100   Metabolic pathways azd01120   Microbial metabolism in diverse environments azd01220   Degradation of aromatic compounds Module azd_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:azd00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CDA09_10425    00361 Chlorocyclohexane and chlorobenzene degradation     CDA09_10425    00623 Toluene degradation     CDA09_10425 Enzymes [BR:azd01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      CDA09_10425     1.14.13.244  phenol 2-monooxygenase (NADH)      CDA09_10425 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  AYH43799 LinkDB All DBs Position 2290236..2290592 Genome browser AA seq 118 aa AA seqDB search MTVAATKEYVGVARDRVENFNGKQLVYASWDHHLLFAAPFLLYAAPQMSFRELVEGPLTA LVQPDPDGAAIDWTQVEWLKSNQPWTPDFERSLADNGIGHKDQIRFRTPNLTTLAVAA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgaccgtagcagcaaccaaggaatacgtcggcgtcgcacgcgaccgcgtagagaacttc aacggcaagcagctggtgtatgcgagctgggatcaccacctgctgttcgcggcgcccttc ctgctgtacgcggcgccgcagatgagcttccgcgagctggtcgaagggccgctgacggcg ctcgtgcagccggacccggacggcgccgcgatcgactggacgcaggtcgagtggctgaag tccaaccagccctggacgccggacttcgagcgcagcctcgcggacaacggcatcggccac aaggaccagatccgcttccgcacgccgaacctgacgactctcgccgtcgccgcctga

DBGET integrated database retrieval system