Azoarcus sp. DN11: CDA09_10450 Help Entry CDA09_10450       CDS       T05691                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism azd  Azoarcus sp. DN11 Pathway azd00362   Benzoate degradation azd00621   Dioxin degradation azd00622   Xylene degradation azd01100   Metabolic pathways azd01120   Microbial metabolism in diverse environments azd01220   Degradation of aromatic compounds Module azd_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:azd00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CDA09_10450    00622 Xylene degradation     CDA09_10450    00621 Dioxin degradation     CDA09_10450 Enzymes [BR:azd01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      CDA09_10450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 DUF7750 RraA-like CHMI Motif Other DBs NCBI-ProteinID:  AYH43804 LinkDB All DBs Position 2295000..2295227 Genome browser AA seq 75 aa AA seqDB search MPIIEMHLAEGRTAEQKRKVANAVTEAVIQALGVKSEAVRVLITEHGNEEFYVAGETLAE RAERQRVAAIVEQGQ NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgcccatcatcgaaatgcatctcgcggagggacgcacggccgagcagaagcgcaaggtc gcgaacgccgtcaccgaagccgtcatccaggcgctcggcgtgaagtccgaggccgtgcgc gtcctgatcaccgaacacggcaacgaggagttctacgttgccggcgaaaccctggcggag cgtgccgaacggcagcgcgtcgccgcaatcgtggagcaaggccaatga

DBGET integrated database retrieval system